Lineage for d1cb6a2 (1cb6 A:1335-1691)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.2: Transferrin [53888] (4 proteins)
further duplication: composed of two two-domain lobes
Protein Lactoferrin [53889] (6 species) 
Species Human (Homo sapiens) [TaxId:9606] [53890] (21 PDB entries) 
Domain d1cb6a2: 1cb6 A:1335-1691 [35841]
complexed with cl
Details for d1cb6a2
PDB Entry: 1cb6 (more details), 2 Å
PDB Description: structure of human apolactoferrin at 2.0 a resolution.
PDB Compounds: (A:) lactotransferrinSCOPe Domain Sequences for d1cb6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cb6a2 c.94.1.2 (A:1335-1691) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
eeevaarrarvvwcavgeqelrkcnqwsglsegsvtcssasttedcialvlkgeadamsl
dggyvytagkcglvpvlaenyksqqssdpdpncvdrpvegylavavvrrsdtsltwnsvk
gkkschtavdrtagwnipmgllfnqtgsckfdeyfsqscapgsdprsnlcalcigdeqge
nkcvpnsneryygytgafrclaenagdvafvkdvtvlqntdgnnneawakdlkladfall
cldgkrkpvtearschlamapnhavvsrmdkverlkqvllhqqakfgrngsdcpdkfclf
qsetknllfndnteclarlhgkttyekylgpqyvagitnlkkcstsplleaceflrk
SCOPe Domain Coordinates for d1cb6a2:
Click to download the PDB-style file with coordinates for d1cb6a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cb6a2:
- d1cb6a2 first appeared (with stable ids) in SCOP 1.55
- d1cb6a2 appears in SCOPe 2.07
View in 3D
