Lineage for d6ew3b_ (6ew3 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996897Species Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries)
  8. 2997012Domain d6ew3b_: 6ew3 B: [358404]
    automated match to d5n4ta_
    complexed with cl, dms, fmt, s3c, zn

Details for d6ew3b_

PDB Entry: 6ew3 (more details), 2.14 Å

PDB Description: crystal structure of the metallo-beta-lactamase vim-2 with ml302f
PDB Compounds: (B:) Metallo-beta-lactamase VIM-2

SCOPe Domain Sequences for d6ew3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ew3b_ d.157.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr

SCOPe Domain Coordinates for d6ew3b_:

Click to download the PDB-style file with coordinates for d6ew3b_.
(The format of our PDB-style files is described here.)

Timeline for d6ew3b_: