Lineage for d6mkec_ (6mke C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941797Species Naegleria fowleri [TaxId:5763] [339972] (2 PDB entries)
  8. 2941802Domain d6mkec_: 6mke C: [358395]
    automated match to d2ki3a_
    complexed with fk5

Details for d6mkec_

PDB Entry: 6mke (more details), 2.05 Å

PDB Description: crystal structure of peptidylprolyl isomerase from naegleria fowleri with bound fk506
PDB Compounds: (C:) peptidylprolyl isomerase

SCOPe Domain Sequences for d6mkec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mkec_ d.26.1.0 (C:) automated matches {Naegleria fowleri [TaxId: 5763]}
tdwipisqdqrlkkkiitagssdeqppigskvsvhytgtltsgkkfdssldrgqpfvftl
gkgevirgwdlgvksmkkgeksyfeipsdyaygnnaipglipanstlmfeiellswk

SCOPe Domain Coordinates for d6mkec_:

Click to download the PDB-style file with coordinates for d6mkec_.
(The format of our PDB-style files is described here.)

Timeline for d6mkec_: