![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
![]() | Protein automated matches [190229] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries) |
![]() | Domain d6gr5a_: 6gr5 A: [358394] automated match to d2xjxa_ complexed with adp, mg |
PDB Entry: 6gr5 (more details), 1.34 Å
SCOPe Domain Sequences for d6gr5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gr5a_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskl dsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiarsgtkafmealqagadism igqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhl kedqteyleerrikeivkkhsqfigypitlfveke
Timeline for d6gr5a_: