Lineage for d1dsn__ (1dsn -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.2: Transferrin [53888] (3 proteins) 
Protein Lactoferrin [53889] (5 species) Species Human (Homo sapiens) [TaxId:9606] [53890] (15 PDB entries) 
Domain d1dsn__: 1dsn - [35837]
Details for d1dsn__
PDB Entry: 1dsn (more details), 2.05 Å
PDB Description: d60s n-terminal lobe human lactoferrin
SCOP Domain Sequences for d1dsn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dsn__ c.94.1.2 (-) Lactoferrin {Human (Homo sapiens)}
rrrsvqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtlsg
gfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrr
tagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkc
afssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvdk
fkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfk
dsaigfsrvpprids
SCOP Domain Coordinates for d1dsn__:
Click to download the PDB-style file with coordinates for d1dsn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dsn__:
- d1dsn__ first appeared (with stable ids) in SCOP 1.55
- d1dsn__ appears in SCOP 1.59
- d1dsn__ appears in the current release, SCOPe 2.08, called d1dsna_
View in 3D