Lineage for d6gsbb2 (6gsb B:86-202)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946509Species Sphingobacterium spiritivorum [TaxId:258] [275548] (3 PDB entries)
  8. 2946515Domain d6gsbb2: 6gsb B:86-202 [358356]
    Other proteins in same PDB: d6gsba1, d6gsba3, d6gsbb1, d6gsbb3
    automated match to d4yeta2
    complexed with mn

Details for d6gsbb2

PDB Entry: 6gsb (more details), 1.45 Å

PDB Description: sphingobacterium sp. t2 manganese superoxide dismutase catalyses the oxidative demethylation of polymeric lignin via generation of hydroxyl radical
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d6gsbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsbb2 d.44.1.0 (B:86-202) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
nkgtkpsaalqkaidetfgsldalkekinaagaarfgsgwawlivdnggklqvtstpnqd
nplmdftkekgtpilgidvwehayylryqnkradylttiwdvinweevsaryekalk

SCOPe Domain Coordinates for d6gsbb2:

Click to download the PDB-style file with coordinates for d6gsbb2.
(The format of our PDB-style files is described here.)

Timeline for d6gsbb2: