SCOPe 2.08: Domain d6gsbb2: 6gsb B:86-202

Lineage for d6gsbb2 (6gsb B:86-202)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Sphingobacterium spiritivorum [TaxId:258] [275548] (3 PDB entries)

8. Domain d6gsbb2: 6gsb B:86-202 [358356]
   Other proteins in same PDB: d6gsba1, d6gsba3, d6gsbb1, d6gsbb3
   automated match to d4yeta2
   complexed with mn

Details for d6gsbb2

PDB Entry: 6gsb, 1.45 Å

PDB Description: sphingobacterium sp. t2 manganese superoxide dismutase catalyses the oxidative demethylation of polymeric lignin via generation of hydroxyl radical

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d6gsbb2:

Sequence; same for both SEQRES and ATOM records:

>d6gsbb2 d.44.1.0 (B:86-202) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
nkgtkpsaalqkaidetfgsldalkekinaagaarfgsgwawlivdnggklqvtstpnqd
nplmdftkekgtpilgidvwehayylryqnkradylttiwdvinweevsaryekalk

Timeline for d6gsbb2:

• d6gsbb2 first appeared in SCOPe 2.07