Lineage for d6gsbb1 (6gsb B:23-85)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. Protein automated matches [226859] (38 species)
    not a true protein
  7. Species Sphingobacterium spiritivorum [TaxId:258] [275545] (3 PDB entries)
  8. Domain d6gsbb1: 6gsb B:23-85 [358355]
    Other proteins in same PDB: d6gsba2, d6gsba3, d6gsbb2, d6gsbb3
    automated match to d4yeta1
    complexed with mn

Details for d6gsbb1

PDB Entry: 6gsb (more details), 1.45 Å

PDB Description: sphingobacterium sp. t2 manganese superoxide dismutase catalyses the oxidative demethylation of polymeric lignin via generation of hydroxyl radical
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d6gsbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsbb1 a.2.11.0 (B:23-85) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
meihhskhaagytanlnkaiagtpaekesienilakvsqysdavrnnagghynhelfwsi
ltp

SCOPe Domain Coordinates for d6gsbb1 are not available.

Timeline for d6gsbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gsbb2, d6gsbb3
View in 3D
Domains from other chains:
(mouse over for more information)
d6gsba1, d6gsba2, d6gsba3