Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (11 families) |
Family a.118.8.0: automated matches [191581] (1 protein) not a true family |
Protein automated matches [191037] (12 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225165] (2 PDB entries) |
Domain d6hpgb_: 6hpg B: [358354] automated match to d2vyib_ |
PDB Entry: 6hpg (more details), 2 Å
SCOPe Domain Sequences for d6hpgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hpgb_ a.118.8.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrl
Timeline for d6hpgb_: