Lineage for d6hpgb_ (6hpg B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726989Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2726990Protein automated matches [191037] (12 species)
    not a true protein
  7. 2727045Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225165] (2 PDB entries)
  8. 2727047Domain d6hpgb_: 6hpg B: [358354]
    automated match to d2vyib_

Details for d6hpgb_

PDB Entry: 6hpg (more details), 2 Å

PDB Description: arabidopsis om64 tpr domain
PDB Compounds: (B:) Outer envelope protein 64, mitochondrial

SCOPe Domain Sequences for d6hpgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hpgb_ a.118.8.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrl

SCOPe Domain Coordinates for d6hpgb_:

Click to download the PDB-style file with coordinates for d6hpgb_.
(The format of our PDB-style files is described here.)

Timeline for d6hpgb_: