SCOP 1.75: Domain d1al3a_: 1al3 A:

Lineage for d1al3a_ (1al3 A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Cofactor-binding fragment of LysR-type protein CysB [53886] (1 species)

7. Species Klebsiella aerogenes [TaxId:28451] [53887] (1 PDB entry)

8. Domain d1al3a_: 1al3 A: [35835]
   complexed with so4

Details for d1al3a_

PDB Entry: 1al3, 1.8 Å

PDB Description: cofactor binding fragment of cysb from klebsiella aerogenes

PDB Compounds: (A:) cys regulon transcriptional activator cysb

SCOP Domain Sequences for d1al3a_:

Sequence; same for both SEQRES and ATOM records:

>d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type protein CysB {Klebsiella aerogenes [TaxId: 28451]}
twpdkgslyvatthtqaryalpgvikgfieryprvslhmhqgsptqiaeavskgnadfai
atealhlyddlvmlpcyhwnrsivvtpehplatkgsvsieelaqyplvtytfgftgrsel
dtafnragltprivftatdadviktyvrlglgvgviasmavdpvsdpdlvkldangifsh
sttkigfrrstflrsymydfiqrfaphltrdvvdtavalrsnedieamfkdiklpek

Timeline for d1al3a_:

• d1al3a_ first appeared (with stable ids) in SCOP 1.55, called d1al3__
  
• d1al3a_ appears in SCOP 1.73
  
• d1al3a_ appears in SCOPe 2.01
  
• d1al3a_ appears in the current release, SCOPe 2.08