Lineage for d1al3__ (1al3 -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28133Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins)
  6. 28134Protein Cofactor-binding fragment of CysB [53886] (1 species)
  7. 28135Species Klebsiella aerogenes [TaxId:28451] [53887] (1 PDB entry)
  8. 28136Domain d1al3__: 1al3 - [35835]

Details for d1al3__

PDB Entry: 1al3 (more details), 1.8 Å

PDB Description: cofactor binding fragment of cysb from klebsiella aerogenes

SCOP Domain Sequences for d1al3__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1al3__ c.94.1.1 (-) Cofactor-binding fragment of CysB {Klebsiella aerogenes}
twpdkgslyvatthtqaryalpgvikgfieryprvslhmhqgsptqiaeavskgnadfai
atealhlyddlvmlpcyhwnrsivvtpehplatkgsvsieelaqyplvtytfgftgrsel
dtafnragltprivftatdadviktyvrlglgvgviasmavdpvsdpdlvkldangifsh
sttkigfrrstflrsymydfiqrfaphltrdvvdtavalrsnedieamfkdiklpek

SCOP Domain Coordinates for d1al3__:

Click to download the PDB-style file with coordinates for d1al3__.
(The format of our PDB-style files is described here.)

Timeline for d1al3__: