Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Sphingobacterium spiritivorum [TaxId:258] [275548] (3 PDB entries) |
Domain d6gscb2: 6gsc B:86-202 [358345] Other proteins in same PDB: d6gsca1, d6gsca3, d6gscb1, d6gscb3 automated match to d4yeta2 complexed with mn |
PDB Entry: 6gsc (more details), 1.32 Å
SCOPe Domain Sequences for d6gscb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gscb2 d.44.1.0 (B:86-202) automated matches {Sphingobacterium spiritivorum [TaxId: 258]} nkgtkpsaalqkaidetfgsldalkekinaagaarfgsgwawlivdnggklqvtstpnqd nplmdftkekgtpilgidvwehayylryqnkradylttiwdvinweevsaryekalk
Timeline for d6gscb2: