![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.0: automated matches [191581] (1 protein) not a true family |
![]() | Protein automated matches [191037] (12 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225165] (2 PDB entries) |
![]() | Domain d6hpge_: 6hpg E: [358337] automated match to d2vyib_ |
PDB Entry: 6hpg (more details), 2 Å
SCOPe Domain Sequences for d6hpge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hpge_ a.118.8.0 (E:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrl
Timeline for d6hpge_: