Lineage for d1woda_ (1wod A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. Protein Molybdate-binding protein, ModA [53883] (3 species)
  7. Species Escherichia coli [TaxId:562] [53884] (2 PDB entries)
  8. Domain d1woda_: 1wod A: [35832]
    complexed with wo4

Details for d1woda_

PDB Entry: 1wod (more details), 1.75 Å

PDB Description: crystal structure of moda, a molybdate protein, complexed with tungstate
PDB Compounds: (A:) moda

SCOPe Domain Sequences for d1woda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woda_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]}
gkitvfaaasltnamqdiatqfkkekgvdvvssfassstlarqieagapadlfisadqkw
mdyavdkkaidtatrqtllgnslvvvapkasvqkdftidsktnwtsllnggrlavgdpeh
vpagiyakealqklgawdtlspklapaedvrgalalverneaplgivygsdavaskgvkv
vatfpedshkkveypvavveghnnatvkafydylkgpqaaeifkrygftik

SCOPe Domain Coordinates for d1woda_ are not available.

Timeline for d1woda_: