![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
![]() | Protein Intracellular protease [52326] (3 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [52327] (3 PDB entries) |
![]() | Domain d6f2hl_: 6f2h L: [358319] automated match to d1g2ia_ complexed with 7mt, iod, tb |
PDB Entry: 6f2h (more details), 2.19 Å
SCOPe Domain Sequences for d6f2hl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f2hl_ c.23.16.2 (L:) Intracellular protease {Pyrococcus horikoshii [TaxId: 53953]} mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
Timeline for d6f2hl_: