SCOPe 2.07: Domain d6gsba1: 6gsb A:23-85

Lineage for d6gsba1 (6gsb A:23-85)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (38 species)
   not a true protein

7. Species Sphingobacterium spiritivorum [TaxId:258] [275545] (3 PDB entries)

8. Domain d6gsba1: 6gsb A:23-85 [358288]
   Other proteins in same PDB: d6gsba2, d6gsba3, d6gsbb2, d6gsbb3
   automated match to d4yeta1
   complexed with mn

Details for d6gsba1

PDB Entry: 6gsb, 1.45 Å

PDB Description: sphingobacterium sp. t2 manganese superoxide dismutase catalyses the oxidative demethylation of polymeric lignin via generation of hydroxyl radical

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d6gsba1:

Sequence; same for both SEQRES and ATOM records:

>d6gsba1 a.2.11.0 (A:23-85) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
meihhskhaagytanlnkaiagtpaekesienilakvsqysdavrnnagghynhelfwsi
ltp

Timeline for d6gsba1:

• d6gsba1 is new in SCOPe 2.07-stable
  
• d6gsba1 appears in the current release, SCOPe 2.08