Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (46 species) not a true protein |
Species Aeromonas hydrophila [TaxId:380703] [327104] (5 PDB entries) |
Domain d6if8c1: 6if8 C:1-230 [358286] Other proteins in same PDB: d6if8a2, d6if8b2, d6if8c2, d6if8d2 automated match to d4f3ka_ complexed with ade |
PDB Entry: 6if8 (more details), 2 Å
SCOPe Domain Sequences for d6if8c1:
Sequence, based on SEQRES records: (download)
>d6if8c1 c.56.2.0 (C:1-230) automated matches {Aeromonas hydrophila [TaxId: 380703]} mkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkvaasvats lllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqmaqqpaafp cdetliavaqdciaeqgkhqtkvglictgdqfmckpdaiakaradfpqmlavemegaaig qvchmfkvpylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl
>d6if8c1 c.56.2.0 (C:1-230) automated matches {Aeromonas hydrophila [TaxId: 380703]} mkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkvaasvats lllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqmaqqpaafp cdetliavaqdckvglictgdqfmckpdaiakaradfpqmlavemegaaigqvchmfkvp ylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl
Timeline for d6if8c1: