Lineage for d6h1na1 (6h1n A:5-150)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. Protein automated matches [195066] (5 species)
    not a true protein
  7. Species Zebrafish (Danio rerio) [TaxId:7955] [358283] (1 PDB entry)
  8. Domain d6h1na1: 6h1n A:5-150 [358284]
    Other proteins in same PDB: d6h1na2
    automated match to d5b1za_
    complexed with act, so4

Details for d6h1na1

PDB Entry: 6h1n (more details), 2 Å

PDB Description: crystal structure of a zebra-fish pro-survival protein nrz-apo
PDB Compounds: (A:) BCL2-like 10 (Apoptosis facilitator)

SCOPe Domain Sequences for d6h1na1:

Sequence, based on SEQRES records: (download)

>d6h1na1 f.1.4.0 (A:5-150) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mscwlreqtlllaedyisfcsgiqqtppsesaeamrylakemeqqhrtkfrslsqefldt
cgadpskclqsvmrelvgdgkmnwgrvvsiftftgvlasellsrgensegsrrlaetiad
ylggekqdwlvenggwegfcrffhna

Sequence, based on observed residues (ATOM records): (download)

>d6h1na1 f.1.4.0 (A:5-150) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mscwlreqtlllaedyisfcsgiqqtppsesaeamrylakemeqqhrtkfrslsqefldt
cgadpskclqsvmrelvgdgkmnwgrvvsiftftgvlasellsrgeegsrrlaetiadyl
ggekqdwlvenggwegfcrffhna

SCOPe Domain Coordinates for d6h1na1 are not available.

Timeline for d6h1na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h1na2