Lineage for d6frnd2 (6frn D:256-409)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465166Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2465167Protein automated matches [190158] (30 species)
    not a true protein
  7. 2465288Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (4 PDB entries)
  8. 2465302Domain d6frnd2: 6frn D:256-409 [358270]
    Other proteins in same PDB: d6frna1, d6frnb1, d6frnc1, d6frnd1
    automated match to d2ohha2
    complexed with 7mt, ca, fmn, gol, na, pe4, tb

Details for d6frnd2

PDB Entry: 6frn (more details), 1.74 Å

PDB Description: structure of f420h2 oxidase (fpra) co-crystallized with 10mm tb-xo4 and calcium chloride
PDB Compounds: (D:) F420H2 oxidase (FprA)

SCOPe Domain Sequences for d6frnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frnd2 c.23.5.0 (D:256-409) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg
aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev
ldeyelyyvptedelekcynmgkrlavkvkemkt

SCOPe Domain Coordinates for d6frnd2:

Click to download the PDB-style file with coordinates for d6frnd2.
(The format of our PDB-style files is described here.)

Timeline for d6frnd2: