![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (31 species) not a true protein |
![]() | Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358261] (4 PDB entries) |
![]() | Domain d6frna1: 6frn A:1-255 [358262] Other proteins in same PDB: d6frna2, d6frnb2, d6frnc2, d6frnd2 automated match to d2ohha1 complexed with 7mt, ca, fmn, gol, na, pe4, tb |
PDB Entry: 6frn (more details), 1.74 Å
SCOPe Domain Sequences for d6frna1:
Sequence, based on SEQRES records: (download)
>d6frna1 d.157.1.0 (A:1-255) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]} mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd pmkvigayqdfatgk
>d6frna1 d.157.1.0 (A:1-255) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]} mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp slkgapfkvvkslesidlggktltflepdsmftlyaeegilfsndafgqhlcftqrfdhe ipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtdpmkvig ayqdfatgk
Timeline for d6frna1: