Lineage for d6f2ha_ (6f2h A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858933Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2859056Protein Intracellular protease [52326] (3 species)
  7. 2859061Species Pyrococcus horikoshii [TaxId:53953] [52327] (3 PDB entries)
  8. 2859068Domain d6f2ha_: 6f2h A: [358244]
    automated match to d1g2ia_
    complexed with 7mt, iod, tb

Details for d6f2ha_

PDB Entry: 6f2h (more details), 2.19 Å

PDB Description: structure of protease 1 from pyrococcus horikoshii co-crystallized in presence of 10 mm tb-xo4 and potassium iodide.
PDB Compounds: (A:) Deglycase PH1704

SCOPe Domain Sequences for d6f2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f2ha_ c.23.16.2 (A:) Intracellular protease {Pyrococcus horikoshii [TaxId: 53953]}
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

SCOPe Domain Coordinates for d6f2ha_:

Click to download the PDB-style file with coordinates for d6f2ha_.
(The format of our PDB-style files is described here.)

Timeline for d6f2ha_: