Lineage for d6dnta_ (6dnt A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455957Species Methanobrevibacter ruminantium [TaxId:634498] [358227] (1 PDB entry)
  8. 2455958Domain d6dnta_: 6dnt A: [358228]
    automated match to d6aqyf_
    complexed with edo, epz, nad, zn

Details for d6dnta_

PDB Entry: 6dnt (more details), 1.66 Å

PDB Description: udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid
PDB Compounds: (A:) NAD-dependent epimerase/dehydratase

SCOPe Domain Sequences for d6dnta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dnta_ c.2.1.0 (A:) automated matches {Methanobrevibacter ruminantium [TaxId: 634498]}
mkdknvvvtgglgfigshivdaliddnkvtiidnlssgkmenlnnpnhenltiikedlmd
adlekilkdkdyvfhlaalasvpgsvaeplrynqnnidaslklfiacknnnikkvifsss
savygenpnmplkesenflpcspyaaqkascelylksfhesygldyvalryfnvfgprqd
enspyaavipkfisailngespviygdgeqsrdfiyvkeiakanilsaesdyngvinval
gksmtinrlfeiisdvlesdidvkylderpgdikhsladisnldkisfkpdedkfeeqlr
etvkwfisqm

SCOPe Domain Coordinates for d6dnta_:

Click to download the PDB-style file with coordinates for d6dnta_.
(The format of our PDB-style files is described here.)

Timeline for d6dnta_: