Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Rickettsia rickettsii [TaxId:392021] [358212] (1 PDB entry) |
Domain d6dlkb3: 6dlk B:249-379 [358215] Other proteins in same PDB: d6dlka4, d6dlkb4 automated match to d5w7za3 complexed with edo |
PDB Entry: 6dlk (more details), 2 Å
SCOPe Domain Sequences for d6dlkb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dlkb3 d.131.1.0 (B:249-379) automated matches {Rickettsia rickettsii [TaxId: 392021]} stfipessssklvinrkmfadsieriaiitvekfravklslsretleisavgeargnake vinssqdkesfyeynsdeslaigfnpqyledvlkavksdlvelyfsdvsapvlikfpenp kdifvvmpvkv
Timeline for d6dlkb3:
View in 3D Domains from other chains: (mouse over for more information) d6dlka1, d6dlka2, d6dlka3, d6dlka4 |