Lineage for d6dlkb2 (6dlk B:123-248)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977461Species Rickettsia rickettsii [TaxId:392021] [358212] (1 PDB entry)
  8. 2977466Domain d6dlkb2: 6dlk B:123-248 [358214]
    Other proteins in same PDB: d6dlka4, d6dlkb4
    automated match to d5w7za2
    complexed with edo

Details for d6dlkb2

PDB Entry: 6dlk (more details), 2 Å

PDB Description: crystal structure of dna polymerase iii subunit beta from rickettsia rickettsii
PDB Compounds: (B:) Beta sliding clamp

SCOPe Domain Sequences for d6dlkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dlkb2 d.131.1.0 (B:123-248) automated matches {Rickettsia rickettsii [TaxId: 392021]}
npeasfkisctdfakiiestkfsisldetrynlngvylhikdkefcsastdghrlsiswv
tlekqiknfgvilpqksaeeilkivkdpkninedieillnsnkikficnentimlsklid
gtfpdy

SCOPe Domain Coordinates for d6dlkb2:

Click to download the PDB-style file with coordinates for d6dlkb2.
(The format of our PDB-style files is described here.)

Timeline for d6dlkb2: