Lineage for d6b6ia_ (6b6i A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2798027Species Norovirus gii.4 [TaxId:489821] [358193] (1 PDB entry)
  8. 2798028Domain d6b6ia_: 6b6i A: [358194]
    automated match to d2fyqa_

Details for d6b6ia_

PDB Entry: 6b6i (more details), 2.44 Å

PDB Description: 2.4a resolution structure of human norovirus gii.4 protease
PDB Compounds: (A:) 3C-like protease

SCOPe Domain Sequences for d6b6ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b6ia_ b.47.1.4 (A:) automated matches {Norovirus gii.4 [TaxId: 489821]}
appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqg

SCOPe Domain Coordinates for d6b6ia_:

Click to download the PDB-style file with coordinates for d6b6ia_.
(The format of our PDB-style files is described here.)

Timeline for d6b6ia_: