Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species Norovirus gii.4 [TaxId:489821] [358193] (1 PDB entry) |
Domain d6b6ia_: 6b6i A: [358194] automated match to d2fyqa_ |
PDB Entry: 6b6i (more details), 2.44 Å
SCOPe Domain Sequences for d6b6ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b6ia_ b.47.1.4 (A:) automated matches {Norovirus gii.4 [TaxId: 489821]} appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqg
Timeline for d6b6ia_: