SCOPe 2.08: Domain d1ftka_: 1ftk A:

Lineage for d1ftka_ (1ftk A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)

8. Domain d1ftka_: 1ftk A: [35819]
   complexed with kai

Details for d1ftka_

PDB Entry: 1ftk, 1.6 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2i) in complex with kainate at 1.6 a resolution

PDB Compounds: (A:) glutamate receptor subunit 2

SCOPe Domain Sequences for d1ftka_:

Sequence, based on SEQRES records:

>d1ftka_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkpgtdgn
piesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegva
rvrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavl
klneqglldklknkwwydkgec

Sequence, based on observed residues (ATOM records):

>d1ftka_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkkmlegneryegycvdlaaeiakhcgfkykltivgdgkygarda
dtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikesaedlskqt
eiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgkyayl
lestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneqglldklk
nkwwydkgec

Timeline for d1ftka_:

• d1ftka_ first appeared (with stable ids) in SCOP 1.55
  
• d1ftka_ appears in SCOPe 2.07