SCOPe 2.08: Domain d6a8pc2: 6a8p C:146-463

Lineage for d6a8pc2 (6a8p C:146-463)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.4: Transglutaminase core [54044] (3 proteins)

6. Protein Transglutaminase catalytic domain [54045] (4 species)

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (5 PDB entries)
   GDP-binding protein

8. Domain d6a8pc2: 6a8p C:146-463 [358182]
   Other proteins in same PDB: d6a8pa1, d6a8pa3, d6a8pa4, d6a8pa5, d6a8pb1, d6a8pb3, d6a8pb4, d6a8pb5, d6a8pc1, d6a8pc3, d6a8pc4
   automated match to d3ly6a2
   complexed with gtp; mutant

Details for d6a8pc2

PDB Entry: 6a8p, 2.54 Å

PDB Description: transglutaminase 2 mutant g224v in complex with gtp

PDB Compounds: (C:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d6a8pc2:

Sequence; same for both SEQRES and ATOM records:

>d6a8pc2 d.3.1.4 (C:146-463) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfedgildiclilldvnpkflk
nagrdcsrrsspvyvgrvvsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk
nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg
dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls
tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky
pegsseereaftranhln

Timeline for d6a8pc2:

• d6a8pc2 first appeared in SCOPe 2.07