Lineage for d1gggb_ (1ggg B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914291Protein Glutamine-binding protein [53879] (1 species)
  7. 2914292Species Escherichia coli [TaxId:562] [53880] (2 PDB entries)
  8. 2914295Domain d1gggb_: 1ggg B: [35818]

Details for d1gggb_

PDB Entry: 1ggg (more details), 2.3 Å

PDB Description: glutamine binding protein open ligand-free structure
PDB Compounds: (B:) glutamine binding protein

SCOPe Domain Sequences for d1gggb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gggb_ c.94.1.1 (B:) Glutamine-binding protein {Escherichia coli [TaxId: 562]}
lvvatdtafvpfefkqgdlyvgfdvdlwaaiakelkldyelkpmdfsgiipalqtknvdl
alagititderkkaidfsdgyyksgllvmvkannndvksvkdldgkvvavksgtgsvdya
kaniktkdlrqfpnidnaymelgtnradavlhdtpnilyfiktagngqfkavgdsleaqq
ygiafpkgsdelrdkvngalktlrengtyneiykkwfgte

SCOPe Domain Coordinates for d1gggb_:

Click to download the PDB-style file with coordinates for d1gggb_.
(The format of our PDB-style files is described here.)

Timeline for d1gggb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ggga_