SCOPe 2.08: Domain d1gggb_: 1ggg B:

Lineage for d1gggb_ (1ggg B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamine-binding protein [53879] (1 species)

7. Species Escherichia coli [TaxId:562] [53880] (2 PDB entries)

8. Domain d1gggb_: 1ggg B: [35818]

Details for d1gggb_

PDB Entry: 1ggg, 2.3 Å

PDB Description: glutamine binding protein open ligand-free structure

PDB Compounds: (B:) glutamine binding protein

SCOPe Domain Sequences for d1gggb_:

Sequence; same for both SEQRES and ATOM records:

>d1gggb_ c.94.1.1 (B:) Glutamine-binding protein {Escherichia coli [TaxId: 562]}
lvvatdtafvpfefkqgdlyvgfdvdlwaaiakelkldyelkpmdfsgiipalqtknvdl
alagititderkkaidfsdgyyksgllvmvkannndvksvkdldgkvvavksgtgsvdya
kaniktkdlrqfpnidnaymelgtnradavlhdtpnilyfiktagngqfkavgdsleaqq
ygiafpkgsdelrdkvngalktlrengtyneiykkwfgte

Timeline for d1gggb_:

• d1gggb_ first appeared (with stable ids) in SCOP 1.55
  
• d1gggb_ appears in SCOPe 2.07