Lineage for d6mfua_ (6mfu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871818Species Cryptococcus neoformans [TaxId:235443] [321716] (3 PDB entries)
  8. 2871821Domain d6mfua_: 6mfu A: [358174]
    automated match to d1lvga_
    complexed with 5gp, adp

Details for d6mfua_

PDB Entry: 6mfu (more details), 1.6 Å

PDB Description: crystal structure of a guanylate kinase from cryptococcus neoformans var. grubii serotype a in complex with gdp and adp
PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d6mfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mfua_ c.37.1.0 (A:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
srpinpdvvnrplvicgpsgtgkstllktlfesqpntfgfsvshttrkprpgeengreyh
fvtkeefmegvgkgeflewaefggncygttfaaltalhprrcildielqgvlqlkakapl
qtpplepvflflsppsisqlksrlsgrgtetdasirkrldaakeelryakegkydvyvvn
ddlkvageklekvamgwegwktcgdtlpelnlaeld

SCOPe Domain Coordinates for d6mfua_:

Click to download the PDB-style file with coordinates for d6mfua_.
(The format of our PDB-style files is described here.)

Timeline for d6mfua_: