Lineage for d6a8pb4 (6a8p B:586-687)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373287Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2373288Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2373289Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2373362Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries)
    GDP-binding protein
  8. 2373380Domain d6a8pb4: 6a8p B:586-687 [358171]
    Other proteins in same PDB: d6a8pa1, d6a8pa2, d6a8pa5, d6a8pb1, d6a8pb2, d6a8pb5, d6a8pc1, d6a8pc2
    automated match to d3ly6a4
    complexed with gtp; mutant

Details for d6a8pb4

PDB Entry: 6a8p (more details), 2.54 Å

PDB Description: transglutaminase 2 mutant g224v in complex with gtp
PDB Compounds: (B:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d6a8pb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a8pb4 b.1.5.1 (B:586-687) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
npeikirilgepkqkrklvaevslqnplpvalegctftvegaglteeqktveipdpveag
eevkvrmdllplhmglhklvvnfesdklkavkgfrnviigpa

SCOPe Domain Coordinates for d6a8pb4:

Click to download the PDB-style file with coordinates for d6a8pb4.
(The format of our PDB-style files is described here.)

Timeline for d6a8pb4: