Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
Protein Transglutaminase catalytic domain [54045] (4 species) |
Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (5 PDB entries) GDP-binding protein |
Domain d6a8pb2: 6a8p B:146-463 [358169] Other proteins in same PDB: d6a8pa1, d6a8pa3, d6a8pa4, d6a8pa5, d6a8pb1, d6a8pb3, d6a8pb4, d6a8pb5, d6a8pc1, d6a8pc3, d6a8pc4 automated match to d3ly6a2 complexed with gtp; mutant |
PDB Entry: 6a8p (more details), 2.54 Å
SCOPe Domain Sequences for d6a8pb2:
Sequence, based on SEQRES records: (download)
>d6a8pb2 d.3.1.4 (B:146-463) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfedgildiclilldvnpkflk nagrdcsrrsspvyvgrvvsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky pegsseereaftranhln
>d6a8pb2 d.3.1.4 (B:146-463) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfedgildiclilldvnpkflk nagrdcsrrsspvyvgrvvsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqyccgpvpvraikegdlstkydap fvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtykypegsse ereaftranhln
Timeline for d6a8pb2:
View in 3D Domains from same chain: (mouse over for more information) d6a8pb1, d6a8pb3, d6a8pb4, d6a8pb5 |