Lineage for d1wdna_ (1wdn A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846542Protein Glutamine-binding protein [53879] (1 species)
  7. 846543Species Escherichia coli [TaxId:562] [53880] (2 PDB entries)
  8. 846544Domain d1wdna_: 1wdn A: [35816]

Details for d1wdna_

PDB Entry: 1wdn (more details), 1.94 Å

PDB Description: glutamine-binding protein
PDB Compounds: (A:) glutamine binding protein

SCOP Domain Sequences for d1wdna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]}
klvvatdtafvpfefkqgdlyvgfdvdlwaaiakelkldyelkpmdfsgiipalqtknvd
lalagititderkkaidfsdgyyksgllvmvkannndvksvkdldgkvvavksgtgsvdy
akaniktkdlrqfpnidnaymelgtnradavlhdtpnilyfiktagngqfkavgdsleaq
qygiafpkgsdelrdkvngalktlrengtyneiykkwfgtepk

SCOP Domain Coordinates for d1wdna_:

Click to download the PDB-style file with coordinates for d1wdna_.
(The format of our PDB-style files is described here.)

Timeline for d1wdna_: