Lineage for d1wdna_ (1wdn A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins) 
Protein Glutamine-binding protein [53879] (1 species) Species Escherichia coli [TaxId:562] [53880] (2 PDB entries) 
Domain d1wdna_: 1wdn A: [35816]
Details for d1wdna_
PDB Entry: 1wdn (more details), 1.94 Å
PDB Description: glutamine-binding protein
SCOP Domain Sequences for d1wdna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli}
klvvatdtafvpfefkqgdlyvgfdvdlwaaiakelkldyelkpmdfsgiipalqtknvd
lalagititderkkaidfsdgyyksgllvmvkannndvksvkdldgkvvavksgtgsvdy
akaniktkdlrqfpnidnaymelgtnradavlhdtpnilyfiktagngqfkavgdsleaq
qygiafpkgsdelrdkvngalktlrengtyneiykkwfgtepk
SCOP Domain Coordinates for d1wdna_:
Click to download the PDB-style file with coordinates for d1wdna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wdna_:
- d1wdna_ appears in SCOP 1.57
- d1wdna_ appears in the current release, SCOPe 2.08
View in 3D