Lineage for d1wdna_ (1wdn A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28133Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins)
  6. 28185Protein Glutamine-binding protein [53879] (1 species)
  7. 28186Species Escherichia coli [TaxId:562] [53880] (2 PDB entries)
  8. 28187Domain d1wdna_: 1wdn A: [35816]

Details for d1wdna_

PDB Entry: 1wdn (more details), 1.94 Å

PDB Description: glutamine-binding protein

SCOP Domain Sequences for d1wdna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli}
klvvatdtafvpfefkqgdlyvgfdvdlwaaiakelkldyelkpmdfsgiipalqtknvd
lalagititderkkaidfsdgyyksgllvmvkannndvksvkdldgkvvavksgtgsvdy
akaniktkdlrqfpnidnaymelgtnradavlhdtpnilyfiktagngqfkavgdsleaq
qygiafpkgsdelrdkvngalktlrengtyneiykkwfgtepk

SCOP Domain Coordinates for d1wdna_:

Click to download the PDB-style file with coordinates for d1wdna_.
(The format of our PDB-style files is described here.)

Timeline for d1wdna_: