SCOPe 2.08: Domain d6g46c1: 6g46 C:7-120

Lineage for d6g46c1 (6g46 C:7-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families)

5. Family b.1.12.0: automated matches [227279] (1 protein)
   not a true family

6. Protein automated matches [227090] (1 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (11 PDB entries)

8. Domain d6g46c1: 6g46 C:7-120 [358156]
   Other proteins in same PDB: d6g46a2, d6g46b2, d6g46c2, d6g46d2
   automated match to d1kbpa1
   complexed with edo, elh, fe, gol, ipa, na, nag, so4, zn

Details for d6g46c1

PDB Entry: 6g46, 2.4 Å

PDB Description: red kidney bean purple acid phosphatase in complex with 2-(naphthalen- 1-yl)thiazole-4-carboxylic acid

PDB Compounds: (C:) Fe(3+)-Zn(2+) purple acid phosphatase

SCOPe Domain Sequences for d6g46c1:

Sequence; same for both SEQRES and ATOM records:

>d6g46c1 b.1.12.0 (C:7-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d6g46c1:

• d6g46c1 first appeared in SCOPe 2.07