SCOPe 2.07: Domain d6ev2b1: 6ev2 B:1-106

Lineage for d6ev2b1 (6ev2 B:1-106)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
Domain d6ev2b1: 6ev2 B:1-106 [358146]
Other proteins in same PDB: d6ev2b2, d6ev2d2, d6ev2f2, d6ev2h2
automated match to d1um5l1
complexed with bgc

Details for d6ev2b1

PDB Entry: 6ev2 (more details), 2.4 Å

PDB Description: crystal structure of antibody against schizophyllan in complex with laminarihexaose

PDB Compounds: (B:) light chain

SCOPe Domain Sequences for d6ev2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ev2b1 b.1.1.0 (B:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklelk

SCOPe Domain Coordinates for d6ev2b1:

Click to download the PDB-style file with coordinates for d6ev2b1.
(The format of our PDB-style files is described here.)

Timeline for d6ev2b1: