Lineage for d6dxqa_ (6dxq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2834067Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2834068Protein automated matches [190150] (36 species)
    not a true protein
  7. 2834280Species Sphingobium sp. [TaxId:627192] [339663] (5 PDB entries)
  8. 2834288Domain d6dxqa_: 6dxq A: [358140]
    automated match to d4ofca_
    complexed with 7qd, zn

Details for d6dxqa_

PDB Entry: 6dxq (more details), 2.02 Å

PDB Description: crystal structure of the ligj hydratase product complex with 4- carboxy-4-hydroxy-2-oxoadipate
PDB Compounds: (A:) 4-oxalomesaconate hydratase

SCOPe Domain Sequences for d6dxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dxqa_ c.1.9.0 (A:) automated matches {Sphingobium sp. [TaxId: 627192]}
iidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlikerga
dmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadmts
siaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsgsc
npamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladmlk
qpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfddt
kryidaldisdqerhaifegntrrvfprldaklkargl

SCOPe Domain Coordinates for d6dxqa_:

Click to download the PDB-style file with coordinates for d6dxqa_.
(The format of our PDB-style files is described here.)

Timeline for d6dxqa_: