Lineage for d1a99c_ (1a99 C:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins) 
Protein Putrescine receptor (PotF) [53877] (1 species) Species Escherichia coli [TaxId:562] [53878] (1 PDB entry) 
Domain d1a99c_: 1a99 C: [35814]
Details for d1a99c_
PDB Entry: 1a99 (more details), 2.2 Å
PDB Description: putrescine receptor (potf) from e. coli
SCOP Domain Sequences for d1a99c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a99c_ c.94.1.1 (C:) Putrescine receptor (PotF) {Escherichia coli}
qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg
SCOP Domain Coordinates for d1a99c_:
Click to download the PDB-style file with coordinates for d1a99c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a99c_:
- d1a99c_ appears in SCOP 1.57
- d1a99c_ appears in the current release, SCOPe 2.08
View in 3D
