![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Putrescine receptor (PotF) [53877] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53878] (1 PDB entry) |
![]() | Domain d1a99c_: 1a99 C: [35814] complexed with put has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1a99 (more details), 2.2 Å
SCOPe Domain Sequences for d1a99c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a99c_ c.94.1.1 (C:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]} qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg
Timeline for d1a99c_: