Lineage for d5zxba_ (5zxb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979767Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species)
    PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinase
  7. 2979768Species Human (Homo sapiens) [TaxId:9606] [111201] (11 PDB entries)
    Uniprot Q07912 117-389
  8. 2979779Domain d5zxba_: 5zxb A: [358135]
    automated match to d4ewha_
    complexed with 9ko

Details for d5zxba_

PDB Entry: 5zxb (more details), 2.2 Å

PDB Description: crystal structure of ack1 with compound 10d
PDB Compounds: (A:) Activated CDC42 kinase 1

SCOPe Domain Sequences for d5zxba_:

Sequence, based on SEQRES records: (download)

>d5zxba_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
pqdiynvmvqcwahkpedrptfvalrdflleaq

Sequence, based on observed residues (ATOM records): (download)

>d5zxba_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgvvrrgewdapsgktvsvavkclamddfirevnamhsldhrn
lirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgyleskrf
ihrdlaarnlllatrdlvkigdfpfawcapeslktrtfshasdtwmfgvtlwemftygqe
pwiglngsqilhkidkegerlprpedcpqdiynvmvqcwahkpedrptfvalrdflleaq

SCOPe Domain Coordinates for d5zxba_:

Click to download the PDB-style file with coordinates for d5zxba_.
(The format of our PDB-style files is described here.)

Timeline for d5zxba_: