SCOP 1.75: Domain d1a99b_: 1a99 B:

Lineage for d1a99b_ (1a99 B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Putrescine receptor (PotF) [53877] (1 species)

7. Species Escherichia coli [TaxId:562] [53878] (1 PDB entry)

8. Domain d1a99b_: 1a99 B: [35813]

Details for d1a99b_

PDB Entry: 1a99, 2.2 Å

PDB Description: putrescine receptor (potf) from e. coli

PDB Compounds: (B:) putrescine-binding protein

SCOP Domain Sequences for d1a99b_:

Sequence; same for both SEQRES and ATOM records:

>d1a99b_ c.94.1.1 (B:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]}
qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg

Timeline for d1a99b_:

• d1a99b_ first appeared (with stable ids) in SCOP 1.55
  
• d1a99b_ appears in SCOP 1.73
  
• d1a99b_ appears in SCOPe 2.01
  
• d1a99b_ appears in the current release, SCOPe 2.08