Lineage for d1a99a_ (1a99 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75273Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 75274Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 75275Family c.94.1.1: Phosphate binding protein-like [53851] (17 proteins)
  6. 75429Protein Putrescine receptor (PotF) [53877] (1 species)
  7. 75430Species Escherichia coli [TaxId:562] [53878] (1 PDB entry)
  8. 75431Domain d1a99a_: 1a99 A: [35812]

Details for d1a99a_

PDB Entry: 1a99 (more details), 2.2 Å

PDB Description: putrescine receptor (potf) from e. coli

SCOP Domain Sequences for d1a99a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli}
qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg

SCOP Domain Coordinates for d1a99a_:

Click to download the PDB-style file with coordinates for d1a99a_.
(The format of our PDB-style files is described here.)

Timeline for d1a99a_: