![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) ![]() |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins) |
![]() | Protein Putrescine receptor (PotF) [53877] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53878] (1 PDB entry) |
![]() | Domain d1a99a_: 1a99 A: [35812] |
PDB Entry: 1a99 (more details), 2.2 Å
SCOP Domain Sequences for d1a99a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli} qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg
Timeline for d1a99a_: