Lineage for d1a99a_ (1a99 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. Protein Putrescine receptor (PotF) [53877] (1 species)
  7. Species Escherichia coli [TaxId:562] [53878] (1 PDB entry)
  8. Domain d1a99a_: 1a99 A: [35812]
    complexed with put

Details for d1a99a_

PDB Entry: 1a99 (more details), 2.2 Å

PDB Description: putrescine receptor (potf) from e. coli
PDB Compounds: (A:) putrescine-binding protein

SCOPe Domain Sequences for d1a99a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]}
qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg

SCOPe Domain Coordinates for d1a99a_ are not available.

Timeline for d1a99a_:

Domains from other chains:
(mouse over for more information)
d1a99b_, d1a99c_, d1a99d_