SCOPe 2.07: Domain d5nhnb1: 5nhn B:3-231

Lineage for d5nhnb1 (5nhn B:3-231)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (22 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (63 PDB entries)

8. Domain d5nhnb1: 5nhn B:3-231 [358110]
   Other proteins in same PDB: d5nhna2, d5nhnb2
   automated match to d2b3pa_
   complexed with db5, edo, gol

Details for d5nhnb1

PDB Entry: 5nhn, 1.96 Å

PDB Description: super-folder green fluorescent protein artificiall dimer linked via 148 position

PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d5nhnb1:

Sequence; same for both SEQRES and ATOM records:

>d5nhnb1 d.22.1.1 (B:3-231) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
ielkgidfkedgnilghkleynfnsknvyitadkqkngikanfkirhnvedgsvqladhy
qqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith

Timeline for d5nhnb1:

• d5nhnb1 is new in SCOPe 2.07-stable
  
• d5nhnb1 appears in the current release, SCOPe 2.08