Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (22 species) not a true protein |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (63 PDB entries) |
Domain d5nhnb1: 5nhn B:3-231 [358110] Other proteins in same PDB: d5nhna2, d5nhnb2 automated match to d2b3pa_ complexed with db5, edo, gol |
PDB Entry: 5nhn (more details), 1.96 Å
SCOPe Domain Sequences for d5nhnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nhnb1 d.22.1.1 (B:3-231) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr ielkgidfkedgnilghkleynfnsknvyitadkqkngikanfkirhnvedgsvqladhy qqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith
Timeline for d5nhnb1: