Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
Protein automated matches [190524] (2 species) not a true protein |
Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (11 PDB entries) |
Domain d6g46b2: 6g46 B:121-432 [358102] Other proteins in same PDB: d6g46a1, d6g46b1, d6g46c1, d6g46d1 automated match to d1kbpa2 complexed with edo, elh, fe, gol, ipa, na, nag, so4, zn |
PDB Entry: 6g46 (more details), 2.4 Å
SCOPe Domain Sequences for d6g46b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g46b2 d.159.1.1 (B:121-432) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]} qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf fnrhwypvddst
Timeline for d6g46b2: