Lineage for d5yu2e_ (5yu2 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2959051Species Staphylococcus aureus [TaxId:158878] [358090] (1 PDB entry)
  8. 2959056Domain d5yu2e_: 5yu2 E: [358093]
    Other proteins in same PDB: d5yu2a2
    automated match to d3m1xa_

Details for d5yu2e_

PDB Entry: 5yu2 (more details), 1.75 Å

PDB Description: structure of ribonuclease yabj
PDB Compounds: (E:) Translation initiation inhibitor homologue

SCOPe Domain Sequences for d5yu2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yu2e_ d.79.1.0 (E:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenlkvvl
eeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkveielv
skik

SCOPe Domain Coordinates for d5yu2e_:

Click to download the PDB-style file with coordinates for d5yu2e_.
(The format of our PDB-style files is described here.)

Timeline for d5yu2e_: