SCOPe 2.03: Domain d1poy2_: 1poy 2:

Lineage for d1poy2_ (1poy 2:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Spermidine/putrescine-binding protein PotD [53875] (1 species)

7. Species Escherichia coli [TaxId:562] [53876] (2 PDB entries)

8. Domain d1poy2_: 1poy 2: [35809]
   complexed with spd

Details for d1poy2_

PDB Entry: 1poy, 2.5 Å

PDB Description: spermidine/putrescine-binding protein complexed with spermidine (dimer form)

PDB Compounds: (2:) spermidine/putrescine-binding protein

SCOPe Domain Sequences for d1poy2_:

Sequence; same for both SEQRES and ATOM records:

>d1poy2_ c.94.1.1 (2:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]}
nntlyfynwteyvppglleqftketgikviystyesnetmyaklktykdgaydlvvpsty
yvdkmrkegmiqkidkskltnfsnldpdmlnkpfdpnndysipyiwgataigvngdavdp
ksvtswadlwkpeykgsllltddarevfqmalrklgysgnttdpkeieaaynelkklmpn
vaafnsdnpanpymegevnlgmiwngsafvarqagtpidvvwpkeggifwmdslaipana
knkegalklinfllrpdvakqvaetigyptpnlaarkllspevandktlypdaetiknge
wqndvgaassiyeeyyqklkagr

Timeline for d1poy2_:

• d1poy2_ first appeared (with stable ids) in SCOP 1.55
  
• d1poy2_ appears in SCOPe 2.02
  
• d1poy2_ appears in SCOPe 2.04
  
• d1poy2_ appears in the current release, SCOPe 2.08