Lineage for d1poy2_ (1poy 2:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75273Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 75274Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 75275Family c.94.1.1: Phosphate binding protein-like [53851] (17 proteins)
  6. 75435Protein Spermidine/putrescine-binding protein PotD [53875] (1 species)
  7. 75436Species Escherichia coli [TaxId:562] [53876] (2 PDB entries)
  8. 75439Domain d1poy2_: 1poy 2: [35809]

Details for d1poy2_

PDB Entry: 1poy (more details), 2.5 Å

PDB Description: spermidine/putrescine-binding protein complexed with spermidine (dimer form)

SCOP Domain Sequences for d1poy2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poy2_ c.94.1.1 (2:) Spermidine/putrescine-binding protein PotD {Escherichia coli}
nntlyfynwteyvppglleqftketgikviystyesnetmyaklktykdgaydlvvpsty
yvdkmrkegmiqkidkskltnfsnldpdmlnkpfdpnndysipyiwgataigvngdavdp
ksvtswadlwkpeykgsllltddarevfqmalrklgysgnttdpkeieaaynelkklmpn
vaafnsdnpanpymegevnlgmiwngsafvarqagtpidvvwpkeggifwmdslaipana
knkegalklinfllrpdvakqvaetigyptpnlaarkllspevandktlypdaetiknge
wqndvgaassiyeeyyqklkagr

SCOP Domain Coordinates for d1poy2_:

Click to download the PDB-style file with coordinates for d1poy2_.
(The format of our PDB-style files is described here.)

Timeline for d1poy2_: