Lineage for d5wiyb1 (5wiy B:325-612)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2418094Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2418095Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2418104Protein automated matches [190126] (2 species)
    not a true protein
  7. 2418105Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries)
  8. 2418131Domain d5wiyb1: 5wiy B:325-612 [358088]
    Other proteins in same PDB: d5wiyb2
    automated match to d2dyha_
    complexed with 1xm, so4

Details for d5wiyb1

PDB Entry: 5wiy (more details), 2.23 Å

PDB Description: kelch domain of human keap1 bound to small molecule inhibitor fragment: 4-amino-1,7-dihydro-6h-pyrazolo[3,4-d]pyrimidine-6-thione
PDB Compounds: (B:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d5wiyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wiyb1 b.68.11.1 (B:325-612) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
tirsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqg
riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavtmep

SCOPe Domain Coordinates for d5wiyb1:

Click to download the PDB-style file with coordinates for d5wiyb1.
(The format of our PDB-style files is described here.)

Timeline for d5wiyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5wiyb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5wiya_