SCOPe 2.07: Domain d5wiyb1: 5wiy B:325-612

Lineage for d5wiyb1 (5wiy B:325-612)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (2 families)

5. Family b.68.11.1: Kelch motif [117282] (2 proteins)
   Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)

6. Protein automated matches [190126] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries)

8. Domain d5wiyb1: 5wiy B:325-612 [358088]
   Other proteins in same PDB: d5wiyb2
   automated match to d2dyha_
   complexed with 1xm, so4

Details for d5wiyb1

PDB Entry: 5wiy, 2.23 Å

PDB Description: kelch domain of human keap1 bound to small molecule inhibitor fragment: 4-amino-1,7-dihydro-6h-pyrazolo[3,4-d]pyrimidine-6-thione

PDB Compounds: (B:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d5wiyb1:

Sequence; same for both SEQRES and ATOM records:

>d5wiyb1 b.68.11.1 (B:325-612) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
tirsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqg
riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavtmep

Timeline for d5wiyb1:

• d5wiyb1 is new in SCOPe 2.07-stable
  
• d5wiyb1 appears in the current release, SCOPe 2.08