SCOPe 2.07: Domain d6dg2b2: 6dg2 B:109-213

Lineage for d6dg2b2 (6dg2 B:109-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d6dg2b2: 6dg2 B:109-213 [358081]
   Other proteins in same PDB: d6dg2b1, d6dg2d1
   automated match to d1n0xl2

Details for d6dg2b2

PDB Entry: 6dg2, 1.96 Å

PDB Description: antigen binding fragment of the pan-ebolavirus monoclonal antibody 6d6

PDB Compounds: (B:) 6D6 Fab light chain

SCOPe Domain Sequences for d6dg2b2:

Sequence; same for both SEQRES and ATOM records:

>d6dg2b2 b.1.1.2 (B:109-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrg

Timeline for d6dg2b2:

• d6dg2b2 is new in SCOPe 2.07-stable
  
• d6dg2b2 appears in the current release, SCOPe 2.08