Lineage for d6dg2b2 (6dg2 B:109-213)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. Domain d6dg2b2: 6dg2 B:109-213 [358081]
    Other proteins in same PDB: d6dg2a1, d6dg2a2, d6dg2b1, d6dg2c1, d6dg2c2, d6dg2d1
    automated match to d1n0xl2

Details for d6dg2b2

PDB Entry: 6dg2 (more details), 1.96 Å

PDB Description: antigen binding fragment of the pan-ebolavirus monoclonal antibody 6d6
PDB Compounds: (B:) 6D6 Fab light chain

SCOPe Domain Sequences for d6dg2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dg2b2 b.1.1.2 (B:109-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrg

SCOPe Domain Coordinates for d6dg2b2 are not available.

Timeline for d6dg2b2:

Domains from same chain:
(mouse over for more information)
d6dg2b1
Domains from other chains:
(mouse over for more information)
d6dg2a1, d6dg2a2, d6dg2c1, d6dg2c2, d6dg2d1, d6dg2d2